Rabbit UGT1A1 antibody
-
Catalog number70R-7289
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenUGT1A1 antibody was raised using the N terminal of UGT1A1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
-
SpecificityUGT1A1 antibody was raised against the N terminal of UGT1A1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT1A1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolUGT1A1
-
Short nameRabbit UGT1A1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal UGT1A1 antibody raised against the N terminal of UGT1A1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetUDP glucuronosyltransferase 1 family, polypeptide A1, UGT1A1 and IDBG-407489 and ENSG00000241635 and 54658, transferase activity, Plasma membranes, Ugt1a1 and IDBG-488785 and ENSMUSG00000089960 and 394436, BT.63686 and IDBG-641949 and ENSBTAG00000026181 and 286792,751790
-
Gene info
-
Identity
-
Gene
-
Long gene nameUDP glucuronosyltransferase family 1 member A1
-
Synonyms gene
-
Synonyms gene name
- UDP glycosyltransferase 1 family, polypeptide A1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1989-02-13
-
Entrez gene record
-
Pubmed identfication
-
Classification
- UDP glucuronosyltransferases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data