Rabbit UCHL5 antibody
-
Catalog number70R-3208
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenUCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK
-
SpecificityUCHL5 antibody was raised against the middle region of UCHL5
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UCHL5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolUCHL5
-
Short nameRabbit UCHL5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal UCHL5 antibody raised against the middle region of UCHL5
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetubiquitin carboxyl-terminal hydrolase L5, UCHL5 and IDBG-105454 and ENSG00000116750 and 51377, proteasome binding, nuclei, Uchl5 and IDBG-197081 and ENSMUSG00000018189 and 56207, UCHL5 and IDBG-629660 and ENSBTAG00000013620 and 282110
-
Gene info
-
Identity
-
Gene
-
Long gene nameubiquitin C-terminal hydrolase L5
-
Synonyms gene name
- ubiquitin carboxyl-terminal hydrolase L5
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2002-11-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ubiquitin C-terminal hydrolases
- INO80 complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data