Rabbit UBE3A antibody
-
Catalog number70R-5247
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenUBE3A antibody was raised using the middle region of Ube3A corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
-
SpecificityUBE3A antibody was raised against the middle region of Ube3A
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE3A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSNHG14, UBE3A
-
Short nameRabbit UBE3A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal UBE3A antibody raised against the middle region of Ube3A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetubiquitin protein ligase E3A, ANCR and AS and E6-AP and EPVE6AP and HPVE6A, UBE3A and IDBG-4274 and ENSG00000114062 and 7337, ligase activity, nuclei, Ube3a and IDBG-190437 and ENSMUSG00000025326 and 22215, UBE3A and IDBG-628537 and ENSBTAG00000002487 and 100335247,533136
-
Gene info
-
Identity
-
Gene
-
Long gene namesmall nucleolar RNA host gene 14
-
Synonyms gene
-
Synonyms gene name
- UBE3A antisense RNA 1 (non-protein coding)
- small nucleolar RNA host gene 14 (non-protein coding)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2009-10-16
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Small nucleolar RNA non-coding host genes
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameubiquitin protein ligase E3A
-
Synonyms gene
-
Synonyms gene name
- human papilloma virus E6-associated protein
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1993-10-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- HECT domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data