Rabbit UBE2I antibody

• Catalog number
  70R-1080
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Protein Modification & Stress Response
• Immunogen
  UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA
• Specificity
  NA
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2I antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  UBE2I  
• Gene symbol
  UBE2I
• Short name
  Rabbit UBE2I antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal UBE2I antibody
• Alternative technique
  antibodies, rabbit-anti

Gene info

• Identity
  HGNC:12485
• Gene
  UBE2I
• Long gene name
  ubiquitin conjugating enzyme E2 I
• Synonyms gene name
  • ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9)
  • ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast)
  • ubiquitin-conjugating enzyme E2I
• Synonyms
  • UBC9
• GenBank acession
  • D45050
• Locus
  16p13.3
• Discovery year
  1995-07-11
• Entrez gene record
  7329
• Pubmed identfication
  • 8565643
• RefSeq identity
  • NM_003345
• Classification
  • Ubiquitin conjugating enzymes E2
• VEGA ID
  OTTHUMG00000186701

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products