Rabbit TTC6 antibody
-
Catalog number70R-2757
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenTTC6 antibody was raised using the C terminal of TTC6 corresponding to a region with amino acids MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY
-
SpecificityTTC6 antibody was raised against the C terminal of TTC6
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC6 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTTC6, TRE-TTC6-1
-
Short nameRabbit TTC6 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TTC6 antibody raised against the C terminal of TTC6
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene nametetratricopeptide repeat domain 6
-
Synonyms gene
-
Synonyms gene name
- non-protein coding RNA 291
- chromosome 14 open reading frame 25
-
GenBank acession
-
Locus
-
Discovery year2002-11-20
-
Entrez gene record
-
RefSeq identity
-
Classification
- Tetratricopeptide repeat domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nametRNA-Glu (anticodon TTC) 6-1
-
Synonyms gene
-
Synonyms gene name
- transfer RNA glutamic acid 32 (anticodon UUC) pseudogene
- transfer RNA-Glu (TTC) 6-1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2008-08-29
-
Entrez gene record
-
RefSeq identity
-
Classification
- Cytoplasmic transfer RNA pseudogenes
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data