Rabbit TSTA3 antibody
-
Catalog number70R-6048
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenTSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
-
SpecificityTSTA3 antibody was raised against the N terminal of TSTA3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSTA3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGFUS
-
Short nameRabbit TSTA3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TSTA3 antibody raised against the N terminal of TSTA3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettissue specific transplantation antigen P35B, FX and P35B and SDR4E1, TSTA3 and IDBG-38856 and ENSG00000104522 and 7264, coenzyme binding, Cytoplasm, Tsta3 and IDBG-151936 and ENSMUSG00000022570 and 22122, TSTA3 and IDBG-643791 and ENSBTAG00000034691 and 513158
-
Gene info
-
Identity
-
Gene
-
Long gene nameGDP-L-fucose synthase
-
Synonyms gene
-
Synonyms gene name
- tissue specific transplantation antigen P35B
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-03-20
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Short chain dehydrogenase/reductase superfamily
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data