Rabbit TMEM173 antibody
-
Catalog number70R-2359
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenTMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL
-
SpecificityTMEM173 antibody was raised against the middle region of TMEM173
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM173 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSTING1
-
Short nameRabbit TMEM173 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TMEM173 antibody raised against the middle region of TMEM173
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettransmembrane protein 173, TMEM173 and IDBG-47893 and ENSG00000184584 and 340061, cyclic-GMP-AMP binding, Plasma membranes, Tmem173 and IDBG-137341 and ENSMUSG00000024349 and 72512, TMEM173 and IDBG-646026 and ENSBTAG00000002296 and 533661
-
Gene info
-
Identity
-
Gene
-
Long gene namestimulator of interferon response cGAMP interactor 1
-
Synonyms gene
-
Synonyms gene name
- transmembrane protein 173
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2006-08-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data