Rabbit TLR5 antibody
-
Catalog number70R-5979
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenTLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
-
SpecificityTLR5 antibody was raised against the N terminal of TLR5
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TLR5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTLR5
-
Short nameRabbit TLR5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TLR5 antibody raised against the N terminal of TLR5
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettoll-like receptor 5, MELIOS and SLE1 and SLEB1 and TIL3, TLR5 and IDBG-106840 and ENSG00000187554 and 7100, protein binding, Plasma membranes, Tlr5 and IDBG-259066 and ENSMUSG00000079164 and 53791, TLR5 and IDBG-648348 and ENSBTAG00000000477 and 444870
-
Gene info
-
Identity
-
Gene
-
Long gene nametoll like receptor 5
-
Synonyms gene
-
Synonyms gene name
- systemic lupus erythematosus susceptibility 1
- toll-like receptor 5
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1998-06-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Toll like receptors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data