Rabbit TINAG antibody
-
Catalog number70R-4464
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaMiscellaneous
-
ImmunogenTINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
-
SpecificityTINAG antibody was raised against the middle region of TINAG
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TINAG antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTINAG, TINAG-AS1
-
Short nameRabbit TINAG antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TINAG antibody raised against the middle region of TINAG
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettubulointerstitial nephritis antigen, TINAG and IDBG-91109 and ENSG00000137251 and 27283, polysaccharide binding, multiple, Tinag and IDBG-185797 and ENSMUSG00000032357 and 26944, TINAG and IDBG-628721 and ENSBTAG00000012652 and 512517
-
Gene info
-
Identity
-
Gene
-
Long gene nametubulointerstitial nephritis antigen
-
GenBank acession
-
Locus
-
Discovery year2001-04-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Peptidase family C1
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameTINAG antisense RNA 1
-
Locus
-
Discovery year2020-03-30
-
Entrez gene record
-
Classification
- Antisense RNAs
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data