Rabbit Tektin 4 antibody
-
Catalog number70R-3595
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenTektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA
-
SpecificityTektin 4 antibody was raised against the N terminal of TEKT4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TEKT4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTEKT4, TEKT4P3, TEKT4P1
-
Short nameRabbit Tektin 4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal Tektin 4 antibody raised against the N terminal of TEKT4
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene nametektin 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-12-06
-
Entrez gene record
-
RefSeq identity
-
Classification
- Tektins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nametektin 4 pseudogene 3
-
Locus
-
Discovery year2011-06-14
-
Entrez gene record
-
RefSeq identity
Gene info
-
Identity
-
Gene
-
Long gene nametektin 4 pseudogene 1
-
Locus
-
Discovery year2010-02-03
-
Entrez gene record
-
RefSeq identity
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data