Rabbit TEC antibody
-
Catalog number70R-4469
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenTEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG
-
SpecificityTEC antibody was raised against the middle region of TEC
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TEC antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTEC
-
Short nameRabbit TEC antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TEC antibody raised against the middle region of TEC
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targettec protein tyrosine kinase, PSCTK4, TEC and IDBG-17328 and ENSG00000135605 and 7006, transferase activity, Cell surfaces, Tec and IDBG-170167 and ENSMUSG00000029217 and 21682, TEC and IDBG-642096 and ENSBTAG00000005062 and 504733
-
Gene info
-
Identity
-
Gene
-
Long gene nametec protein tyrosine kinase
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-12-15
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Tec family tyrosine kinases
- SH2 domain containing
- Pleckstrin homology domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data