Rabbit TCL1A antibody
-
Catalog number70R-2449
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenTCL1A antibody was raised using the N terminal of TCL1A corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
-
SpecificityTCL1A antibody was raised against the N terminal of TCL1A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TCL1A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTCL1A
-
Short nameRabbit TCL1A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TCL1A antibody raised against the N terminal of TCL1A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetT-cell leukemia/lymphoma 1A, TCL1, TCL1A and IDBG-18937 and ENSG00000100721 and 8115, protein binding, nuclei, Tcl1 and IDBG-169124 and ENSMUSG00000041359 and 21432, TCL1A and IDBG-634173 and ENSBTAG00000019580 and 506540
-
Gene info
-
Identity
-
Gene
-
Long gene nameTCL1 family AKT coactivator A
-
Synonyms gene name
- T cell leukemia/lymphoma 1A
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-03
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data