Rabbit SYVN1 antibody

• Catalog number
  70R-1869
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Cycle & Cell Death
• Immunogen
  SYVN1 antibody was raised using the middle region of SYVN1 corresponding to a region with amino acids QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA
• Specificity
  SYVN1 antibody was raised against the middle region of SYVN1
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SYVN1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  SYVN1  
• Gene symbol
  SYVN1
• Short name
  Rabbit SYVN1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal SYVN1 antibody raised against the middle region of SYVN1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  synovial apoptosis inhibitor 1, synoviolin, SYVN1 and IDBG-56611 and ENSG00000162298 and 102465449,84447, metal ion binding, nuclei, Syvn1 and IDBG-134090 and ENSMUSG00000024807 and 74126, BT.54995 and IDBG-644142 and ENSBTAG00000005076 and 508358

Gene info

• Identity
  HGNC:20738
• Gene
  SYVN1
• Long gene name
  synoviolin 1
• Synonyms gene name
  • synovial apoptosis inhibitor 1, synoviolin
• Synonyms
  • HRD1
  • DER3
• Synonyms name
  • HMG-coA reductase degradation 1 homolog (S. cerevisiae)
• GenBank acession
  • AB085847
• Locus
  11q13.1
• Discovery year
  2004-07-28
• Entrez gene record
  84447
• Pubmed identfication
  • 12975321
• RefSeq identity
  • NM_032431
• Classification
  • MicroRNA protein coding host genes
  • Ring finger proteins
• VEGA ID
  OTTHUMG00000165607

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products