Rabbit STAMBP antibody
-
Catalog number70R-5741
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Cycle & Cell Death
-
ImmunogenSTAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
-
SpecificitySTAMBP antibody was raised against the N terminal of STAMBP
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STAMBP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSTAMBP
-
Short nameRabbit STAMBP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal STAMBP antibody raised against the N terminal of STAMBP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetSTAM binding protein, AMSH and MICCAP, STAMBP and IDBG-56678 and ENSG00000124356 and 10617, metal ion binding, nuclei, Stambp and IDBG-161393 and ENSMUSG00000006906 and 70527, STAMBP and IDBG-631439 and ENSBTAG00000009600 and 532672
-
Gene info
-
Identity
-
Gene
-
Long gene nameSTAM binding protein
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-02-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- JAMM/MPN+ metallopeptidase family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data