Rabbit SOD1 antibody
-
Catalog number70R-1548
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenSOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
-
SpecificitySOD1 antibody was raised against the N terminal of SOD1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SOD1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSOD1-DT, SOD1
-
Short nameRabbit SOD1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SOD1 antibody raised against the N terminal of SOD1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsuperoxide dismutase 1, soluble, ALS and ALS1 and HEL-S-44 and homodimer and hSod1 and IPOA and SOD, SOD1 and IDBG-1609 and ENSG00000142168 and 6647, chaperone binding, nuclei, Sod1 and IDBG-174662 and ENSMUSG00000022982 and 20655
-
Gene info
-
Identity
-
Gene
-
Long gene nameSOD1 divergent transcript
-
Locus
-
Discovery year2021-07-01
-
Entrez gene record
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene namesuperoxide dismutase 1
-
Synonyms gene
-
Synonyms gene name
- amyotrophic lateral sclerosis 1 (adult)
- superoxide dismutase 1, soluble
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Superoxide dismutases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data