Rabbit SLC5A8 antibody
-
Catalog number70R-7372
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSLC5A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC5A8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSLC5A8
-
Short nameRabbit SLC5A8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SLC5A8 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsolute carrier family 5 (iodide transporter), member 8, SLC5A8 and IDBG-547244 and ENSG00000256870 and 160728, symporter activity, Plasma membranes, Slc5a8 and IDBG-183999 and ENSMUSG00000020062 and 216225, SMCT1 and IDBG-636931 and ENSBTAG00000011525 and 615734
-
Gene info
-
Identity
-
Gene
-
Long gene namesolute carrier family 5 member 8
-
Synonyms gene name
- solute carrier family 5 (iodide transporter), member 8
- solute carrier family 5 (sodium/monocarboxylate cotransporter), member 8
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-05-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Solute carriers
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data