Rabbit SLC5A4 antibody
-
Catalog number70R-1794
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC5A4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSLC5A4-AS1, SLC5A4
-
Short nameRabbit SLC5A4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SLC5A4 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsolute carrier family 5 (low affinity glucose cotransporter), member 4, DJ90G24.4 and SAAT1 and SGLT3, SLC5A4 and IDBG-5028 and ENSG00000100191 and 6527, symporter activity, Plasma membranes, Slc5a4a and IDBG-164503 and ENSMUSG00000020229 and 64452, SLC5A4 and IDBG-636855 and ENSBTAG00000008117 and 527441
-
Gene info
-
Identity
-
Gene
-
Long gene nameSLC5A4 antisense RNA 1
-
Synonyms
-
Locus
-
Discovery year2017-03-03
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namesolute carrier family 5 member 4
-
Synonyms gene name
- solute carrier family 5 (low affinity glucose cotransporter), member 4
- solute carrier family 5 (glucose activated ion channel), member 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-02-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Solute carriers
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data