Rabbit SLC22A18 antibody
-
Catalog number70R-6653
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSLC22A18 antibody was raised using the N terminal of SLC22A18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG
-
SpecificitySLC22A18 antibody was raised against the N terminal of SLC22A18
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A18 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSLC22A18, SLC22A18AS
-
Short nameRabbit SLC22A18 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SLC22A18 antibody raised against the N terminal of SLC22A18
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene namesolute carrier family 22 member 18
-
Synonyms gene
-
Synonyms gene name
- solute carrier family 22 (organic cation transporter), member 1-like
- solute carrier family 22, member 18
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-06-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Solute carriers
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene nameSLC22A18 antisense RNA
-
Synonyms gene
-
Synonyms gene name
- solute carrier family 22 (organic cation transporter), member 1-like antisense
- solute carrier family 22 (organic cation transporter), member 18 antisense
- solute carrier family 22 member 18 antisense
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-05-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data