Rabbit SLC14A1 antibody
-
Catalog number70R-7059
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
-
SpecificitySLC14A1 antibody was raised against the C terminal of SLC14A1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC14A1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSLC14A1
-
Short nameRabbit SLC14A1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SLC14A1 antibody raised against the C terminal of SLC14A1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsolute carrier family 14 (urea transporter), member 1 (Kidd blood group), HsT1341 and HUT11 and JK and RACH1 and RACH2 and UT-B1 and UT1 and UTE, SLC14A1 and IDBG-2812 and ENSG00000141469 and 6563, urea channel activity, Plasma membranes, Slc14a1 and IDBG-160561 and ENSMUSG00000059336 and 108052, SLC14A1 and IDBG-644539 and ENSBTAG00000019870 and 493988
-
Gene info
-
Identity
-
Gene
-
Long gene namesolute carrier family 14 member 1 (Kidd blood group)
-
Synonyms gene
-
Synonyms gene name
- Kidd blood group
- solute carrier family 14 (urea transporter), member 1
- solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-02-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Blood group antigens
- Solute carriers
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data