Rabbit SLC13A3 antibody
-
Catalog number70R-1904
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSLC13A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC13A3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSLC13A3
-
Short nameRabbit SLC13A3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SLC13A3 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsolute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, SLC13A3 and IDBG-79300 and ENSG00000158296 and 64849, dicarboxylate symporter activity, Plasma membranes, Slc13a3 and IDBG-212716 and ENSMUSG00000018459 and 114644, BT.26578 and IDBG-643088 and ENSBTAG00000000873 and 526291
-
Gene info
-
Identity
-
Gene
-
Long gene namesolute carrier family 13 member 3
-
Synonyms gene name
- solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-06-13
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Solute carriers
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data