Rabbit SIPA1 antibody
-
Catalog number70R-6080
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDifferentiation & Development
-
ImmunogenSIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS
-
SpecificitySIPA1 antibody was raised against the middle region of SIPA1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIPA1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSIPA1
-
Short nameRabbit SIPA1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SIPA1 antibody raised against the middle region of SIPA1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsignal-induced proliferation-associated 1, SPA1, SIPA1 and IDBG-242018 and ENSG00000213445 and 6494, Rap GTPase activator activity, nuclei, Sipa1 and IDBG-132413 and ENSMUSG00000056917 and 20469, SIPA1 and IDBG-644217 and ENSBTAG00000013884 and 508234
-
Gene info
-
Identity
-
Gene
-
Long gene namesignal-induced proliferation-associated 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-12-23
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PDZ domain containing
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data