Rabbit SIGLEC7 antibody
-
Catalog number70R-6142
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenSIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL
-
SpecificitySIGLEC7 antibody was raised against the middle region of SIGLEC7
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIGLEC7 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSIGLEC7
-
Short nameRabbit SIGLEC7 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SIGLEC7 antibody raised against the middle region of SIGLEC7
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsialic acid binding Ig-like lectin 7, SIGLEC7 and IDBG-65680 and ENSG00000168995 and 27036, carbohydrate binding, Plasma membranes
-
Gene info
-
Identity
-
Gene
-
Long gene namesialic acid binding Ig like lectin 7
-
Synonyms gene
-
Synonyms gene name
- sialic acid binding Ig-like lectin 19, pseudogene
- sialic acid binding Ig-like lectin, pseudogene 2
- sialic acid binding Ig-like lectin 7
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-01-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- Sialic acid binding Ig like lectins
- V-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data