Rabbit SIGIRR antibody
-
Catalog number70R-6630
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenSIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIGIRR antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSIGIRR
-
Short nameRabbit SIGIRR antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SIGIRR antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsingle immunoglobulin and toll-interleukin 1 receptor (TIR) domain, SIGIRR and IDBG-16551 and ENSG00000185187 and 59307, protein binding, Plasma membranes, Sigirr and IDBG-211977 and ENSMUSG00000025494 and 24058, SIGIRR and IDBG-645604 and ENSBTAG00000011149 and 531801
-
Gene info
-
Identity
-
Gene
-
Long gene namesingle Ig and TIR domain containing
-
Synonyms gene name
- single immunoglobulin and toll-interleukin 1 receptor (TIR) domain
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2005-10-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- TIR domain containing
- Immunoglobulin like domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data