Rabbit SGK3 antibody
-
Catalog number70R-5846
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaHormones & Steroids
-
ImmunogenSGK3 antibody was raised using the N terminal of SGK3 corresponding to a region with amino acids LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH
-
SpecificitySGK3 antibody was raised against the N terminal of SGK3
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SGK3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolC8orf44-SGK3, SGK3
-
Short nameRabbit SGK3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SGK3 antibody raised against the N terminal of SGK3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetserum/glucocorticoid regulated kinase family, member 3, SGK3 and IDBG-23987 and ENSG00000104205 and 100533105,23678, transferase activity, Cytoplasm
-
Gene info
-
Identity
-
Gene
-
Long gene nameC8orf44-SGK3 readthrough
-
Locus
-
Discovery year2013-05-10
-
Entrez gene record
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameserum/glucocorticoid regulated kinase family member 3
-
Synonyms gene
-
Synonyms gene name
- serum/glucocorticoid regulated kinase-like
- serum/glucocorticoid regulated kinase family, member 3
-
Locus
-
Discovery year1999-08-12
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data