Rabbit SFN antibody
-
Catalog number70R-5570
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT
-
SpecificitySFN antibody was raised against the middle region of SFN
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFN antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSFN, REXO2
-
Short nameRabbit SFN antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SFN antibody raised against the middle region of SFN
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetstratifin, YWHAS, SFN and IDBG-94738 and ENSG00000175793 and 2810, phosphoprotein binding, nuclei, Sfn and IDBG-195282 and ENSMUSG00000047281 and 55948, SFN and IDBG-647781 and ENSBTAG00000009223 and 528453
-
Gene info
-
Identity
-
Gene
-
Long gene namestratifin
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-09-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- 14-3-3 phospho-serine/phospho-threonine binding proteins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameRNA exonuclease 2
-
Synonyms gene name
- REX2, RNA exonuclease 2 homolog (S. cerevisiae)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-08-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Exonucleases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data