Rabbit SERPINI1 antibody
-
Catalog number70R-5263
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenSERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF
-
SpecificityNA
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINI1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSERPINI1
-
Short nameRabbit SERPINI1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SERPINI1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetserpin peptidase inhibitor, clade I (neuroserpin), member 1, neuroserpin and PI12, SERPINI1 and IDBG-64026 and ENSG00000163536 and 5274, serine-type endopeptidase inhibitor activity, Extracellular, Serpini1 and IDBG-152513 and ENSMUSG00000027834 and 20713, BT.19231 and IDBG-636831 and ENSBTAG00000012708 and 509976
-
Gene info
-
Identity
-
Gene
-
Long gene nameserpin family I member 1
-
Synonyms gene
-
Synonyms gene name
- serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-12-20
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Serpin peptidase inhibitors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data