Rabbit SERPIND1 antibody
-
Catalog number70R-5267
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenSERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPIND1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSERPIND1
-
Short nameRabbit SERPIND1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SERPIND1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetserpin peptidase inhibitor, clade D (heparin cofactor), member 1, D22S673 and HC2 and HCF2 and HCII and HLS2 and LS2 and THPH10, SERPIND1 and IDBG-1808 and ENSG00000099937 and 3053, heparin binding, Extracellular, Serpind1 and IDBG-138819 and ENSMUSG00000022766 and 15160, SERPIND1 and IDBG-637655 and ENSBTAG00000013973 and 100125764
-
Gene info
-
Identity
-
Gene
-
Long gene nameserpin family D member 1
-
Synonyms gene
-
Synonyms gene name
- serine (or cysteine) proteinase inhibitor, clade D (heparin cofactor), member 1
- serpin peptidase inhibitor, clade D (heparin cofactor), member 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1988-05-31
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Serpin peptidase inhibitors
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data