Rabbit SEMA3D antibody

• Catalog number
  70R-6406
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
• Specificity
  SEMA3D antibody was raised against the middle region of SEMA3D
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEMA3D antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  SEMA3D  
• Gene symbol
  SEMA3D
• Short name
  Rabbit SEMA3D antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal SEMA3D antibody raised against the middle region of SEMA3D
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D, SEMA3D and IDBG-24627 and ENSG00000153993 and 223117, protein binding, Extracellular, Sema3d and IDBG-135314 and ENSMUSG00000040254 and 108151, SEMA3D and IDBG-630887 and ENSBTAG00000024394 and 536417

Gene info

• Identity
  HGNC:10726
• Gene
  SEMA3D
• Long gene name
  semaphorin 3D
• Synonyms gene name
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
• Synonyms
  • coll-2
  • Sema-Z2
• GenBank acession
  • BC029590
• Locus
  7q21.11
• Discovery year
  1999-06-25
• Entrez gene record
  223117
• RefSeq identity
  • NM_152754
• Classification
  • V-set domain containing
  • Semaphorins
• VEGA ID
  OTTHUMG00000154569

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products