Rabbit SDF4 antibody
-
Catalog number70R-7410
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE
-
SpecificitySDF4 antibody was raised against the middle region of SDF4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SDF4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSDF4
-
Short nameRabbit SDF4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SDF4 antibody raised against the middle region of SDF4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetstromal cell derived factor 4, SDF4 and IDBG-84646 and ENSG00000078808 and 51150, identical protein binding, Plasma membranes, Sdf4 and IDBG-208219 and ENSMUSG00000029076 and 20318, BT.49428 and IDBG-635313 and ENSBTAG00000015642 and 528783
-
Gene info
-
Identity
-
Gene
-
Long gene namestromal cell derived factor 4
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2005-05-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CREC family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data