Rabbit SDCBP antibody

  • Catalog number
    70R-1718
  • Price
    Please ask
  • Size
    100 ug
  • Applications
    WB, IHC
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cytokines & Growth Factors
  • Immunogen
    SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
  • Specificity
    NA
  • Cross Reactivity
    Human,Mouse,Rat,Dog
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SDCBP antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    SDCBP  
  • Gene symbol
    SDCBP
  • Short name
    Rabbit SDCBP antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal SDCBP antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    syndecan binding protein (syntenin), MDA-9 and MDA9 and ST1 and SYCL and TACIP18, SDCBP and IDBG-22706 and ENSG00000137575 and 6386, cell adhesion molecule binding, nuclei, Sdcbp and IDBG-128595 and ENSMUSG00000028249 and 53378, SDCBP and IDBG-644487 and ENSBTAG00000019910 and 510979
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee