Rabbit SCN1B antibody

• Catalog number
  70R-5206
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
• Specificity
  SCN1B antibody was raised against the middle region of SCN1B
• Cross Reactivity
  Human,Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN1B antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  SCN1B  
• Gene symbol
  SCN1B
• Short name
  Rabbit SCN1B antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal SCN1B antibody raised against the middle region of SCN1B
• Alternative technique
  antibodies, rabbit-anti

Gene info

• Identity
  HGNC:10586
• Gene
  SCN1B
• Long gene name
  sodium voltage-gated channel beta subunit 1
• Synonyms gene name
  • sodium channel, voltage-gated, type I, beta polypeptide
  • sodium channel, voltage-gated, type I, beta
  • sodium channel, voltage-gated, type I, beta subunit
  • sodium channel, voltage gated, type I beta subunit
• Locus
  19q13.11
• Discovery year
  1990-05-14
• Entrez gene record
  6324
• Pubmed identfication
  • 8394762
• Classification
  • Sodium voltage-gated channel beta subunits
  • V-set domain containing
• VEGA ID
  OTTHUMG00000182472
• Locus Specific Databases
  • LRG_420

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products