Rabbit SCFD1 antibody
-
Catalog number70R-3833
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME
-
SpecificitySCFD1 antibody was raised against the N terminal of SCFD1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCFD1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSCFD1
-
Short nameRabbit SCFD1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SCFD1 antibody raised against the N terminal of SCFD1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsec1 family domain containing 1, C14orf163 and RA410 and SLY1 and SLY1P and STXBP1L2, SCFD1 and IDBG-4265 and ENSG00000092108 and 23256, protein N-terminus binding, Plasma membranes, Scfd1 and IDBG-137853 and ENSMUSG00000020952 and 76983, SCFD1 and IDBG-632219 and ENSBTAG00000017565 and 100140328
-
Gene info
-
Identity
-
Gene
-
Long gene namesec1 family domain containing 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 14 open reading frame 163
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-03-25
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data