Rabbit SBDS antibody
-
Catalog number70R-1181
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenSBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
-
SpecificitySBDS antibody was raised against the C terminal of SBDS
-
Cross ReactivityHuman,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SBDS antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSBDS
-
Short nameRabbit SBDS antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SBDS antibody raised against the C terminal of SBDS
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetShwachman-Bodian-Diamond syndrome, SBDS and IDBG-18886 and ENSG00000126524 and 51119, poly(A) RNA binding, nuclei, Sbds and IDBG-202307 and ENSMUSG00000025337 and 66711, SBDS and IDBG-639804 and ENSBTAG00000004051 and 513237
-
Gene info
-
Identity
-
Gene
-
Long gene nameSBDS ribosome maturation factor
-
Synonyms gene name
- Shwachman-Bodian-Diamond syndrome
- SBDS, ribosome assembly guanine nucleotide exchange factor
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-07-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ribosomal biogenesis factors
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data