Rabbit S100A9 antibody

• Catalog number
  70R-5716
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  S100A9 antibody was raised using the N terminal of S100A9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK
• Specificity
  S100A9 antibody was raised against the N terminal of S100A9
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of S100A9 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  S100A9  
• Gene symbol
  S100A9
• Short name
  Rabbit S100A9 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal S100A9 antibody raised against the N terminal of S100A9
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  S100 calcium binding protein A9, 60B8AG and CAGB and CFAG and CGLB and L1AG and LIAG and MAC387 and MIF and MRP14 and NIF and P14, S100A9 and IDBG-102644 and ENSG00000163220 and 6280, RAGE receptor binding, nuclei, GM5849 and IDBG-705944 and ENSMUSG00000096621 and 545541, S100A9 and IDBG-632885 and ENSBTAG00000006505 and 532569

Gene info

• Identity
  HGNC:10499
• Gene
  S100A9
• Long gene name
  S100 calcium binding protein A9
• Synonyms gene
  • CAGB
  • CFAG
• Synonyms gene name
  • calgranulin B
  • S100 calcium-binding protein A9 (calgranulin B)
• Synonyms
  • P14
  • MIF
  • NIF
  • LIAG
  • MRP14
  • MAC387
  • 60B8AG
  • CGLB
  • MRP-14
  • S100-A9
• Synonyms name
  • Calprotectin L1H subunit
  • Leukocyte L1 complex heavy chain
  • Migration inhibitory factor-related protein 14
• GenBank acession
  • BC047681
• Locus
  1q21.3
• Discovery year
  1989-05-19
• Entrez gene record
  6280
• RefSeq identity
  • NM_002965
• Classification
  • S100 calcium binding proteins
  • EF-hand domain containing
• VEGA ID
  OTTHUMG00000013125

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products