Rabbit RUFY1 antibody
-
Catalog number70R-2737
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenRUFY1 antibody was raised using the C terminal of RUFY1 corresponding to a region with amino acids QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL
-
SpecificityRUFY1 antibody was raised against the C terminal of RUFY1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RUFY1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRUFY1-AS1, RUFY1
-
Short nameRabbit RUFY1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RUFY1 antibody raised against the C terminal of RUFY1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRUN and FYVE domain containing 1, RUFY1 and IDBG-61405 and ENSG00000176783 and 80230, metal ion binding, nuclei, Rufy1 and IDBG-168794 and ENSMUSG00000020375 and 216724, RUFY1 and IDBG-641115 and ENSBTAG00000019868 and 528153
-
Gene info
-
Identity
-
Gene
-
Long gene nameRUFY1 antisense RNA 1
-
Locus
-
Discovery year2020-03-19
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameRUN and FYVE domain containing 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-11-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Zinc fingers FYVE-type
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data