Rabbit RTN4 antibody
-
Catalog number70R-7139
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenRTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
-
SpecificityRTN4 antibody was raised against the middle region of RTN4
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTN4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRTN4
-
Short nameRabbit RTN4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RTN4 antibody raised against the middle region of RTN4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetreticulon 4, RTN4 and IDBG-52161 and ENSG00000115310 and 57142, poly(A) RNA binding, nuclei, Rtn4 and IDBG-157815 and ENSMUSG00000020458 and 68585, RTN4 and IDBG-633945 and ENSBTAG00000011104 and 359718
-
Gene info
-
Identity
-
Gene
-
Long gene namereticulon 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-11-28
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data