Rabbit RRAGC antibody
-
Catalog number70R-3630
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenRRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
-
SpecificityRRAGC antibody was raised against the N terminal of RRAGC
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RRAGC antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRRAGC-DT, RRAGC
-
Short nameRabbit RRAGC antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RRAGC antibody raised against the N terminal of RRAGC
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRas-related GTP binding C, RRAGC and IDBG-96571 and ENSG00000116954 and 64121, protein heterodimerization activity, nuclei, Rragc and IDBG-186411 and ENSMUSG00000028646 and 54170, RRAGC and IDBG-641031 and ENSBTAG00000009368 and 617367
-
Gene info
-
Identity
-
Gene
-
Long gene nameRRAGC divergent transcript
-
Locus
-
Discovery year2021-07-28
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene nameRas related GTP binding C
-
Synonyms gene name
- Ras-related GTP binding C
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-07-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ras related GTP binding proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data