Rabbit RPS6KB1 antibody
-
Catalog number70R-3692
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenRPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL
-
SpecificityRPS6KB1 antibody was raised against the N terminal of RPS6KB1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS6KB1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRPS6KB1
-
Short nameRabbit RPS6KB1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RPS6KB1 antibody raised against the N terminal of RPS6KB1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetribosomal protein S6 kinase, 70kDa, polypeptide 1, p70 S6KA and p70-alpha and p70-S6K and p70(S6K)-alpha and PS6K and S6K and S6K-beta-1 and S6K1 and STK14A, RPS6KB1 and IDBG-61938 and ENSG00000108443 and 6198, transferase activity, nuclei, Rps6kb1 and IDBG-206895 and ENSMUSG00000020516 and 72508, RPS6KB1 and IDBG-629797 and ENSBTAG00000016851 and 404181
-
Gene info
-
Identity
-
Gene
-
Long gene nameribosomal protein S6 kinase B1
-
Synonyms gene
-
Synonyms gene name
- ribosomal protein S6 kinase, 70kD, polypeptide 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-07-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- AGC family kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data