Rabbit RORA antibody

  • Catalog number
    70R-1937
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cancer
  • Immunogen
    RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY
  • Specificity
    RORA antibody was raised against the N terminal of RORA
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RORA antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    RORA  
  • Gene symbol
    RORA-AS1, RORA-AS2, RORA
  • Short name
    Rabbit RORA antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal RORA antibody raised against the N terminal of RORA
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    RAR-related orphan receptor A, NR1F1 and ROR1 and ROR2 and ROR3 and RZR-ALPHA and RZRA, RORA and IDBG-14920 and ENSG00000069667 and 6095, direct ligand regulated sequence-specific DNA binding transcription factor activity, nuclei, Rora and IDBG-181478 and ENSMUSG00000032238 and 19883, RORA and IDBG-646570 and ENSBTAG00000015904 and 535597,790889
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee