Rabbit RHOT1 antibody
-
Catalog number70R-5954
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenRHOT1 antibody was raised using the middle region of RHOT1 corresponding to a region with amino acids ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR
-
SpecificityRHOT1 antibody was raised against the middle region of RHOT1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOT1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRHOT1
-
Short nameRabbit RHOT1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RHOT1 antibody raised against the middle region of RHOT1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetras homolog family member T1, RHOT1 and IDBG-39866 and ENSG00000126858 and 55288, GTP binding, Plasma membranes, Rhot1 and IDBG-204041 and ENSMUSG00000017686 and 59040, BT.38815 and IDBG-631082 and ENSBTAG00000010001 and 511257
-
Gene info
-
Identity
-
Gene
-
Long gene nameras homolog family member T1
-
Synonyms gene
-
Synonyms gene name
- ras homolog gene family, member T1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2003-07-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- EF-hand domain containing
- Miro like atypical Rho GTPases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data