Rabbit RHOA antibody
-
Catalog number70R-5840
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenRHOA antibody was raised using the middle region of RHOA corresponding to a region with amino acids GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
-
SpecificityRHOA antibody was raised against the middle region of RHOA
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOA antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRHOA-IT1, RHOA
-
Short nameRabbit RHOA antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RHOA antibody raised against the middle region of RHOA
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetras homolog family member A, ARH12 and ARHA and RHO12 and RHOH12, RHOA and IDBG-34732 and ENSG00000067560 and 387, myosin binding, Cell surfaces, 4930544G11Rik and IDBG-153447 and ENSMUSG00000036463 and 67653, RHOA and IDBG-645998 and ENSBTAG00000004279 and 338049
-
Gene info
-
Identity
-
Gene
-
Long gene nameRHOA intronic transcript 1
-
Synonyms gene name
- RHOA intronic transcript 1 (non-protein coding)
-
Locus
-
Discovery year2011-05-24
-
Classification
- Intronic transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameras homolog family member A
-
Synonyms gene
-
Synonyms gene name
- ras homolog gene family, member A
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1990-03-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Rho family GTPases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data