Rabbit RASGRF1 antibody
-
Catalog number70R-5816
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenRASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
-
SpecificityRASGRF1 antibody was raised against the N terminal of RASGRF1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASGRF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRASGRF1
-
Short nameRabbit RASGRF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RASGRF1 antibody raised against the N terminal of RASGRF1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRas protein-specific guanine nucleotide-releasing factor 1, CDC25 and CDC25L and GNRP and GRF1 and GRF55 and H-GRF55 and PP13187 and ras-GRF1, RASGRF1 and IDBG-25346 and ENSG00000058335 and 5923, glutamate receptor binding, Plasma membranes, Rasgrf1 and IDBG-190479 and ENSMUSG00000032356 and 19417, RASGRF1 and IDBG-630181 and ENSBTAG00000019940 and 520039
-
Gene info
-
Identity
-
Gene
-
Long gene nameRas protein specific guanine nucleotide releasing factor 1
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-02-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Dbl family Rho GEFs
- Pleckstrin homology domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data