Rabbit RAD23B antibody
-
Catalog number70R-3309
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenRAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD23B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRAD23B
-
Short nameRabbit RAD23B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RAD23B antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRAD23 homolog B (S. cerevisiae), HHR23B and HR23B and P58, RAD23B and IDBG-79797 and ENSG00000119318 and 5887, polyubiquitin binding, nuclei, Rad23b and IDBG-148611 and ENSMUSG00000028426 and 19359, RAD23B and IDBG-637385 and ENSBTAG00000001926 and 530189
-
Gene info
-
Identity
-
Gene
-
Long gene nameRAD23 homolog B, nucleotide excision repair protein
-
Synonyms gene name
- RAD23 (S. cerevisiae) homolog B
- RAD23 homolog B (S. cerevisiae)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1994-07-20
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Nucleotide excision repair
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data