Rabbit RABGEF1 antibody
-
Catalog number70R-3156
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenRABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RABGEF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRABGEF1
-
Short nameRabbit RABGEF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RABGEF1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRAB guanine nucleotide exchange factor (GEF) 1, RABGEF1 and IDBG-18687 and ENSG00000154710 and 27342, Rab guanyl-nucleotide exchange factor activity, multiple, Rabgef1 and IDBG-202259 and ENSMUSG00000025340 and 56715, RABGEF1 and IDBG-639781 and ENSBTAG00000003842 and 282335
-
Gene info
-
Identity
-
Gene
-
Long gene nameRAB guanine nucleotide exchange factor 1
-
Synonyms gene name
- RAB guanine nucleotide exchange factor (GEF) 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-07-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- VPS9 domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data