Rabbit RAB5B antibody

• Catalog number
  70R-5873
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cancer
• Immunogen
  RAB5B antibody was raised using the N terminal of RAB5B corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
• Specificity
  RAB5B antibody was raised against the N terminal of RAB5B
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB5B antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  RAB5B  
• Gene symbol
  RAB5B
• Short name
  Rabbit RAB5B antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal RAB5B antibody raised against the N terminal of RAB5B
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  RAB5B, member RAS oncogene family, RAB5B and IDBG-39641 and ENSG00000111540 and 102723609,5869, GTP-dependent protein binding, nuclei, Rab5b and IDBG-198109 and ENSMUSG00000000711 and 19344, BT.105383 and IDBG-636405 and ENSBTAG00000014129 and 539150

Gene info

• Identity
  HGNC:9784
• Gene
  RAB5B
• Long gene name
  RAB5B, member RAS oncogene family
• Locus
  12q13.2
• Discovery year
  1994-08-30
• Entrez gene record
  5869
• Pubmed identfication
  • 1541686
  • 10403367
• Classification
  • RAB, member RAS oncogene GTPases
• VEGA ID
  OTTHUMG00000169682

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products