Rabbit RAB27A antibody
-
Catalog number70R-5770
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenRAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG
-
SpecificityRAB27A antibody was raised against the middle region of RAB27A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB27A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRAB27A, TBC1D10B
-
Short nameRabbit RAB27A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RAB27A antibody raised against the middle region of RAB27A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRAB27A, member RAS oncogene family, GS2 and HsT18676 and RAB27 and RAM, RAB27A and IDBG-12971 and ENSG00000069974 and 5873, myosin V binding, Plasma membranes, Rab27a and IDBG-184264 and ENSMUSG00000032202 and 11891
-
Gene info
-
Identity
-
Gene
-
Long gene nameRAB27A, member RAS oncogene family
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1996-11-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RAB, member RAS oncogene GTPases
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene nameTBC1 domain family member 10B
-
Synonyms gene name
- TBC1 domain family, member 10B
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-03-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data