Rabbit RAB22A antibody
-
Catalog number70R-4379
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenRAB22A antibody was raised using the middle region of RAB22A corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
-
SpecificityRAB22A antibody was raised against the middle region of RAB22A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB22A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRAB22A
-
Short nameRabbit RAB22A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal RAB22A antibody raised against the middle region of RAB22A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetRAB22A, member RAS oncogene family, RAB22A and IDBG-82535 and ENSG00000124209 and 57403, GDP binding, nuclei, Rab22a and IDBG-213398 and ENSMUSG00000027519 and 19334, BT.19047 and IDBG-641245 and ENSBTAG00000018053 and 617385
-
Gene info
-
Identity
-
Gene
-
Long gene nameRAB22A, member RAS oncogene family
-
GenBank acession
-
Locus
-
Discovery year2000-05-31
-
Entrez gene record
-
Classification
- RAB, member RAS oncogene GTPases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data