Rabbit PVRL3 antibody
-
Catalog number70R-6424
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaInfectious Disease
-
ImmunogenPVRL3 antibody was raised using the middle region of PVRL3 corresponding to a region with amino acids PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM
-
SpecificityPVRL3 antibody was raised against the middle region of PVRL3
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PVRL3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolNECTIN3-AS1, NECTIN3
-
Short nameRabbit PVRL3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PVRL3 antibody raised against the middle region of PVRL3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpoliovirus receptor-related 3, CD113 and CDW113 and NECTIN-3 and PPR3 and PRR3 and PVRR3, PVRL3 and IDBG-49345 and ENSG00000177707 and 25945, cell adhesion molecule binding, Cell surfaces, Pvrl3 and IDBG-163998 and ENSMUSG00000022656 and 58998, PVRL3 and IDBG-632147 and ENSBTAG00000013769 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameNECTIN3 antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- PVRL3 antisense RNA 1 (non-protein coding)
- PVRL3 antisense RNA 1
-
Locus
-
Discovery year2011-07-28
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namenectin cell adhesion molecule 3
-
Synonyms gene
-
Synonyms gene name
- poliovirus receptor-related 3
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-02-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Nectins and nectin-like molecules
- CD molecules
- C2-set domain containing
- I-set domain containing
- V-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data