Rabbit PUF60 antibody
-
Catalog number70R-1411
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenPUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ
-
SpecificityPUF60 antibody was raised against the C terminal of PUF60
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PUF60 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPUF60
-
Short nameRabbit PUF60 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PUF60 antibody raised against the C terminal of PUF60
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpoly-U binding splicing factor 60KDa, FIR and RoBPI and SIAHBP1 and VRJS, PUF60 and IDBG-39284 and ENSG00000179950 and 22827, poly(A) RNA binding, multiple, Puf60 and IDBG-152633 and ENSMUSG00000002524 and 67959, BT.56130 and IDBG-643754 and ENSBTAG00000037493 and 512824
-
Gene info
-
Identity
-
Gene
-
Long gene namepoly(U) binding splicing factor 60
-
Synonyms gene name
- poly(U) binding splicing factor 60KDa
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2007-07-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RNA binding motif containing
- Spliceosomal A complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data