Rabbit PUF60 antibody

• Catalog number
  70R-1411
• Price
  Please ask
• Size
  100 ug

• Applications
  WB, IHC
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ
• Specificity
  PUF60 antibody was raised against the C terminal of PUF60
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PUF60 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PUF60  
• Gene symbol
  PUF60
• Short name
  Rabbit PUF60 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PUF60 antibody raised against the C terminal of PUF60
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  poly-U binding splicing factor 60KDa, FIR and RoBPI and SIAHBP1 and VRJS, PUF60 and IDBG-39284 and ENSG00000179950 and 22827, poly(A) RNA binding, multiple, Puf60 and IDBG-152633 and ENSMUSG00000002524 and 67959, BT.56130 and IDBG-643754 and ENSBTAG00000037493 and 512824

Gene info

• Identity
  HGNC:17042
• Gene
  PUF60
• Long gene name
  poly(U) binding splicing factor 60
• Synonyms gene name
  • poly(U) binding splicing factor 60KDa
• Synonyms
  • FIR
  • SIAHBP1
  • RoBPI
• Synonyms name
  • siah binding protein 1
  • FBP interacting repressor
  • pyrimidine tract binding splicing factor
  • Ro ribonucleoprotein binding protein 1
• GenBank acession
  • AF114818
• Locus
  8q24.3
• Discovery year
  2007-07-27
• Entrez gene record
  22827
• Pubmed identfication
  • 10668799
  • 10882074
  • 17579712
• RefSeq identity
  • NM_014281
• Classification
  • RNA binding motif containing
  • Spliceosomal A complex
• VEGA ID
  OTTHUMG00000165155

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products