Rabbit PSMG1 antibody
-
Catalog number70R-1967
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenPSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMG1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPSMG1
-
Short nameRabbit PSMG1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PSMG1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetproteasome (prosome, macropain) assembly chaperone 1, C21LRP and DSCR2 and LRPC21 and PAC-1 and PAC1, PSMG1 and IDBG-3364 and ENSG00000183527 and 8624, proteasome binding, nuclei, Psmg1 and IDBG-179306 and ENSMUSG00000022913 and 56088, PSMG1 and IDBG-639136 and ENSBTAG00000013600 and 614817
-
Gene info
-
Identity
-
Gene
-
Long gene nameproteasome assembly chaperone 1
-
Synonyms gene
-
Synonyms gene name
- Down syndrome critical region gene 2
- proteasome (prosome, macropain) assembly chaperone 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-09-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data